| Primary information |
|---|
| ID | 11953 |
| Uniprot ID | C0HJJ2 |
| Description | Glucagon-4 (Glucagon-IV) |
| Organism | Huso dauricus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Chondrostei; Acipenseriformes (sturgeons and paddlefish); Acipenseroidei; Acipenseridae (sturgeons); Husinae; Huso; Huso dauricus (Kaluga sturgeon) (Acipenser dauricus) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. |
| Length | 31 |
| Molecular Weight | 3 |
| Name | Glucagon-4 (Glucagon-IV) |
| Sequence | HSQGMFTNDYSKYLEEKSAKEFVEWLKNGKS |
| Sequence map | 31 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|