| Primary information |
|---|
| ID | 11948 |
| Uniprot ID | P81768 |
| Description | Neurophysin 2 (E-NP) (Neurophysin-II) |
| Organism | Loxodonta africana |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Afrotheria; Proboscidea (elephants); Elephantidae (elephants); Loxodonta; Loxodonta africana (African elephant) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the vasopressin/oxytocin family. |
| Tissue Specificity | NA |
| Post Translational Modification | A shorter neurophysin molecule (1-90) also exists and is probably derived from the complete protein by proteolytic degradation (in vivo or after extraction). |
| Function | Neurophysin 2 specifically binds vasopressin. |
| Length | 92 |
| Molecular Weight | 9 |
| Name | Neurophysin 2 (E-NP) (Neurophysin-II) |
| Sequence | AMSDMELRQCLPCGPGGKGRCFGPSICCGEELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCYEESCVTEPECREGAGIH |
| Sequence map | 92 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|