| Primary information |
|---|
| ID | 11940 |
| Uniprot ID | P63294 |
| Description | Glucagon-like peptide (GLP) |
| Organism | Anguilla anguilla |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Elopocephalai; Elopocephala; Elopomorpha; Anguilliformes (true eels); Anguillidae (freshwater eels); Anguilla; Anguilla anguilla (European freshwater eel) (Muraena anguilla) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | NA |
| Length | 30 |
| Molecular Weight | 3 |
| Name | Glucagon-like peptide (GLP) |
| Sequence | HAEGTYTSDVSSYLQDQAAKEFVSWLKTGR |
| Sequence map | 30 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|