| Primary information |
|---|
| ID | 11936 |
| Uniprot ID | P26349 |
| Description | Exendin-4 (Exenatide) |
| Organism | Heloderma suspectum |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Anguimorpha (anguimorph lizards); Neoanguimorpha (New World anguimorph lizards); Helodermatidae (beaded lizards); Heloderma; |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | Venom protein that mimics the incretin hormone glucagon-like peptide 1 (GLP-1). It stimulates insulin synthesis and secretion; protects against beta-cell apoptosis in response to different insults; and promotes beta-cell proliferation. It also promotes satiety; reduces food intake; reduces fat deposition; reduces body weight and inhibits gastric emptying. Interacts with GLP-1 receptor (GLP1R). Induces hypotension that is mediated by relaxation of cardiac smooth muscle. |
| Length | 87 |
| Molecular Weight | 9 |
| Name | Exendin-4 (Exenatide) |
| Sequence | HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Sequence map | 39 |
| PDB ID | 1JRJ; 2MJ9; 2NAV; 2NAW; 3C59; 3C5T; 5NIQ; 5OTT; 6GDZ; 6GE2; 7MLL; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | Available under the name Byetta and Bydureon (extended-release exenatide) (Amylin Pharmaceuticals). Used for the treatment of type 2 diabetes. Enhances insulin secretion in response to elevated plasma |