| Primary information |
|---|
| ID | 11932 |
| Uniprot ID | P01361 |
| Description | Atrial gland peptide B (ELH-1L) |
| Organism | Aplysia californica |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Spiralia; Lophotrochozoa; Mollusca; Gastropoda; Heterobranchia; Euthyneura; Tectipleura; Aplysiida (sea hares); Aplysioidea; Aplysiidae; Aplysia; Aplysia californica (California sea hare) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the molluscan ELH family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | The atrial gland peptide A and peptide B precursors are the source of the 2 peptides that; upon release from this reproductive system gland; initiate the egg-laying process by exciting the bag cell neurons. These neurons; clustered in neural connectives near the abdominal ganglion; in turn release other peptides that act directly on the ganglion and also; via the circulating hemolymph; on many other organs to control the physiological processes of egg-laying. One of these other peptides is the egg-laying hormone. |
| Length | 122 |
| Molecular Weight | 13 |
| Name | Atrial gland peptide B (ELH-1L) |
| Sequence | AVKSSSYEKYPFDLSKEDGAQPYFMTPRLRFYPI |
| Sequence map | 34 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|