| Primary information |
|---|
| ID | 11931 |
| Uniprot ID | Q9TT95 |
| Description | Galanin-like peptide |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the galanin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Hypothalamic neuropeptide which binds to the G-protein-coupled galanin receptors (GALR1; GALR2 and GALR3). Involved in a large number of putative physiological functions in CNS homeostatic processes; including the regulation of gonadotropin-releasing hormone secretion. |
| Length | 120 |
| Molecular Weight | 12 |
| Name | Galanin-like peptide |
| Sequence | APVHRGRGGWTLNSAGYLLGPVLHPPSRAEGGGKGKTALGILDLWKAIDGLPYPQSQLAS |
| Sequence map | 60 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|