| Primary information |
|---|
| ID | 11930 |
| Uniprot ID | Q810H5 |
| Description | Galanin-like peptide |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the galanin family. |
| Tissue Specificity | Isoform 2 is found in brain; thymus and skin. Isoform 2 is found in the skin; in pericytes covering microvascular arterioles and venules on their abluminal surfaces. In larger vessels; isoform 2 is ex |
| Post Translational Modification | NA |
| Function | [Isoform 1]- Hypothalamic neuropeptide which binds to the G-protein-coupled galanin receptors (GALR1; GALR2 and GALR3). Involved in a large number of putative physiological functions in CNS homeostatic processes; including the regulation of gonadotropin-releasing hormone secretion.; [Isoform 2]- Exhibits antimicrobial activity against Gram-negative bacterias; inducing bacterial membrane blebbing. Exhibits potent and dose-dependent vasoconstrictor and anti-edema activity in the cutaneous microvasculature; a physiologic effects which does not appear to be mediated via GALR1 or GALR2. |
| Length | 117 |
| Molecular Weight | 12 |
| Name | Galanin-like peptide |
| Sequence | APAHRGRGGWTLNSAGYLLGPVLPVSSKADQGRKRDSALEILDLWKIIDGLPYSHSPRMT |
| Sequence map | 60 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|