| Primary information |
|---|
| ID | 11918 |
| Uniprot ID | P0DMC2 |
| Description | Apelin receptor early endogenous ligand (Protein Elabela) (ELA) (Protein Toddler) |
| Organism | Danio rerio |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Danionidae; Danioninae; Danio; Danio rerio (Zebrafish) (Brachydanio rerio) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed from the mid-blastula transition (MBT) to 3 days post-fertilization (dpf) (PubMed-24316148). Ubiquitously expressed in dividing cells of the blastoderm before becoming restricted after gastr |
| Similarity | Belongs to the Elabela/Toddler family. |
| Tissue Specificity | Expressed ubiquitously during late blastula and gastrula stages and becomes restricted to the lateral mesoderm; endoderm; and anterior and posterior notochord after gastrulation (PubMed-24407481). |
| Post Translational Modification | NA |
| Function | Endogenous ligand for the apelin receptor (aplnra and/or aplnrb) |
| Length | 58 |
| Molecular Weight | 7 |
| Name | Apelin receptor early endogenous ligand (Protein Elabela) (ELA) (Protein Toddler) |
| Sequence | DKHGTKHDFLNLRRKYRRHNCPKKRCLPLHSRVPFP |
| Sequence map | 37 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|