| Primary information |
|---|
| ID | 11917 |
| Uniprot ID | Q9UBC7 |
| Description | Galanin-like peptide |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the galanin family. |
| Tissue Specificity | Isoform 2 is found in ganglia of ganglioneuroma and ganglioneuroblastoma; as well as in differentiated tumor cells of neuroblastoma tissues. Not found in undifferentiated neuroblasts. Isoform 2 is fou |
| Post Translational Modification | NA |
| Function | [Isoform 1]- Hypothalamic neuropeptide which binds to the G-protein-coupled galanin receptors (GALR1; GALR2 and GALR3). Involved in a large number of putative physiological functions in CNS homeostatic processes; including the regulation of gonadotropin-releasing hormone secretion.; [Isoform 2]- Exhibits potent and dose-dependent vasoconstrictor and anti-edema activity in the cutaneous microvasculature; a physiologic effects which does not appear to be mediated via GALR1 or GALR2. Exhibits antimicrobial activity against Gram-negative bacterias; inducing bacterial membrane blebbing |
| Length | 116 |
| Molecular Weight | 12 |
| Name | Galanin-like peptide |
| Sequence | APAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPS |
| Sequence map | 60 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|