| Primary information |
|---|
| ID | 11893 |
| Uniprot ID | Q8K1D8 |
| Description | Adropin (Energy homeostasis-associated protein) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | NA |
| Tissue Specificity | Expressed in liver and brain. Expressed in regions of the brain involved in metabolic regulation. |
| Post Translational Modification | NA |
| Function | Involved in the regulation of glucose homeostasis and lipid metabolism. |
| Length | 76 |
| Molecular Weight | 7 |
| Name | Adropin (Energy homeostasis-associated protein) |
| Sequence | CHSRSADVDSLSESSPNSSPGPCPEKAPPPQKPSHEGSYLLQP |
| Sequence map | 43 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|