Primary information |
---|
ID | 11892 |
Uniprot ID | Q06145 |
Description | Gastric inhibitory polypeptide (GIP) (Glucose-dependent insulinotropic polypeptide) |
Organism | Rattus norvegicus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Highly expressed in the duodenum and jejunum. |
Post Translational Modification | NA |
Function | Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion. |
Length | 144 |
Molecular Weight | 16 |
Name | Gastric inhibitory polypeptide (GIP) (Glucose-dependent insulinotropic polypeptide) |
Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ |
Sequence map | 42 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|