| Primary information |
|---|
| ID | 11857 |
| Uniprot ID | P23063 |
| Description | Glucagon-like peptide (GLP) |
| Organism | Hydrolagus colliei |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Chondrichthyes; Holocephali; Chimaeriformes (chimaeras); Chimaeridae (shortnose chimaeras); Hydrolagus; Hydrolagus colliei (Spotted ratfish) (Chimaera colliei) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | NA |
| Length | 38 |
| Molecular Weight | 4 |
| Name | Glucagon-like peptide (GLP) |
| Sequence | HADGIYTSDVASLTDYLKSKRFVESLSNYNKRQNDRRM |
| Sequence map | 38 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|