| Primary information |
|---|
| ID | 11842 |
| Uniprot ID | B3EWY2 |
| Description | Natriuretic peptide Coa_NP2 |
| Organism | Crotalus oreganus abyssus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Serpentes (snakes); Colubroidea; Viperidae; Crotalinae (pit vipers); Crotalus; Crotalus oreganus; Crotalus oreganus abyssus |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the natriuretic peptide family. Snake NP subfamily. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | Snake venom natriuretic peptide that exhibits hypotensive and vasorelaxant effects. Produces a dose-dependent hypotension in rats; followed by significant increases in concentrations of markers of nitric oxide (NO) formation measured in the plasma and vasorelaxation in a thoracic aortic ring bath. The peptide may exert its hypotensive action; at least in part; through stimulation of NO production. The vasorelaxant effect is endothelium-dependent and does not appear to be mediated by the natriuretic peptide receptor-A; as its action is not modified by isatin (a potent NPR1 antagonist). May act by activating the natriuretic peptide receptor-B (NPR2). |
| Length | 32 |
| Molecular Weight | 3 |
| Name | Natriuretic peptide Coa_NP2 |
| Sequence | SYGISSGCFGLKLDRIGTMSGLGCWRLLQDSP |
| Sequence map | 32 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|