Primary information |
---|
ID | 11841 |
Uniprot ID | Q9H1Z8 |
Description | Augurin (Esophageal cancer-related gene 4 protein) (ECRG4) |
Organism | Homo sapiens |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the augurin family. |
Tissue Specificity | Expressed in the brain; with expression in the epithelial cell layer of the choroid plexus (at protein level). |
Post Translational Modification | NA |
Function | Probable hormone that may attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system. ECRG4-induced senescence is characterized by G1 arrest; RB1 dephosphorylation and accelerated CCND1 and CCND3 proteasomal degradation. |
Length | 148 |
Molecular Weight | 17 |
Name | Augurin (Esophageal cancer-related gene 4 protein) (ECRG4) |
Sequence | QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDITYWLNRDRNGHEYYGDYYQRHYDEDSAIGPR |
Sequence map | 62 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|