| Primary information |
|---|
| ID | 11835 |
| Uniprot ID | P20394 |
| Description | Exendin-3 (Glucagon-like 3) |
| Organism | Heloderma horridum horridum |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Anguimorpha (anguimorph lizards); Neoanguimorpha (New World anguimorph lizards); Helodermatidae (beaded lizards); Heloderma; |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | Stimulates vasoactive intestinal peptide (VIP) receptors in high concentrations (100 nM); resulting in both an increase in cAMP and amylase secretion from pancreatic acini; although at low concentrations (between 0.3 and 3 nM) it increases cAMP without stimulating amylase release. Stimulates the GLP-1 receptor (GLP1R). Induces hypotension that is mediated by relaxation of cardiac smooth muscle. |
| Length | 87 |
| Molecular Weight | 9 |
| Name | Exendin-3 (Glucagon-like 3) |
| Sequence | HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
| Sequence map | 39 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|