Primary information |
---|
ID | 11835 |
Uniprot ID | P20394 |
Description | Exendin-3 (Glucagon-like 3) |
Organism | Heloderma horridum horridum |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Anguimorpha (anguimorph lizards); Neoanguimorpha (New World anguimorph lizards); Helodermatidae (beaded lizards); Heloderma; |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the glucagon family. |
Tissue Specificity | Expressed by the venom gland. |
Post Translational Modification | NA |
Function | Stimulates vasoactive intestinal peptide (VIP) receptors in high concentrations (100 nM); resulting in both an increase in cAMP and amylase secretion from pancreatic acini; although at low concentrations (between 0.3 and 3 nM) it increases cAMP without stimulating amylase release. Stimulates the GLP-1 receptor (GLP1R). Induces hypotension that is mediated by relaxation of cardiac smooth muscle. |
Length | 87 |
Molecular Weight | 9 |
Name | Exendin-3 (Glucagon-like 3) |
Sequence | HSDGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS |
Sequence map | 39 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|