| Primary information |
|---|
| ID | 11834 |
| Uniprot ID | P48756 |
| Description | Gastric inhibitory polypeptide (GIP) (Glucose-dependent insulinotropic polypeptide) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion. |
| Length | 144 |
| Molecular Weight | 16 |
| Name | Gastric inhibitory polypeptide (GIP) (Glucose-dependent insulinotropic polypeptide) |
| Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQ |
| Sequence map | 42 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|