| Primary information |
|---|
| ID | 11817 |
| Uniprot ID | D4A540 |
| Description | Augurin (Esophageal cancer-related gene 4 protein homolog) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the augurin family. |
| Tissue Specificity | Expressed in the brain; with expression in the choroid plexus and the ventricular ependymal cells (at protein level). |
| Post Translational Modification | NA |
| Function | Probable hormone that may attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system |
| Length | 148 |
| Molecular Weight | 16 |
| Name | Augurin (Esophageal cancer-related gene 4 protein homolog) |
| Sequence | QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNQNGHDYYGDYYQRHYDEDAAIGPR |
| Sequence map | 62 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|