Primary information |
---|
ID | 11809 |
Uniprot ID | Q9XZE6 |
Description | Eclosion hormone (EH) (Ecdysis activator) (Fragment) |
Organism | Romalea microptera |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Polyneoptera; Orthoptera; Caelifera (grasshoppers and locusts); Acrididea; Acridomorpha; Acridoidea; Romaleidae (lubber grasshoppers); Romaleinae; Romalea; Romalea microptera (Eastern lubber grasshopper) (Romalea guttata) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the insect eclosion hormone family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns- larval; pupal and adult ecdysis; and plasticization during the molt. |
Length | 55 |
Molecular Weight | 5 |
Name | Eclosion hormone (EH) (Ecdysis activator) (Fragment) |
Sequence | CKKMVGAYFEGELCADACLKFKGKMCPTARTSPPSRPSSTSLSSRCCSIKSLCKA |
Sequence map | 55 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|