| Primary information |
|---|
| ID | 11809 |
| Uniprot ID | Q9XZE6 |
| Description | Eclosion hormone (EH) (Ecdysis activator) (Fragment) |
| Organism | Romalea microptera |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Polyneoptera; Orthoptera; Caelifera (grasshoppers and locusts); Acrididea; Acridomorpha; Acridoidea; Romaleidae (lubber grasshoppers); Romaleinae; Romalea; Romalea microptera (Eastern lubber grasshopper) (Romalea guttata) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the insect eclosion hormone family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Neuropeptide that triggers the performance of ecdysis behaviors at the end of a molt. It triggers adult behavior patterns- larval; pupal and adult ecdysis; and plasticization during the molt. |
| Length | 55 |
| Molecular Weight | 5 |
| Name | Eclosion hormone (EH) (Ecdysis activator) (Fragment) |
| Sequence | CKKMVGAYFEGELCADACLKFKGKMCPTARTSPPSRPSSTSLSSRCCSIKSLCKA |
| Sequence map | 55 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|