Primary information |
---|
ID | 11806 |
Uniprot ID | P0DKY6 |
Description | Natriuretic peptide NP2 (NP2_Casca) |
Organism | Crotalus durissus cascavella |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Serpentes (snakes); Colubroidea; Viperidae; Crotalinae (pit vipers); Crotalus; Crotalus durissus (tropical rattlesnake); Cro |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the natriuretic peptide family. |
Tissue Specificity | Expressed by the venom gland. |
Post Translational Modification | NA |
Function | Snake venom natriuretic peptide that shows an increase in perfusion pressure; urinary flow and glomerular filtration rate. Reduces total and proximal tubular transport of sodium. In the aortic ring assay; causes a relaxant effect in endothelium-intact thoracic aortic rings precontracted with phenylephrine in the presence and absence of isatin; a natriuretic receptor antagonist. |
Length | 33 |
Molecular Weight | 3 |
Name | Natriuretic peptide NP2 (NP2_Casca) |
Sequence | VSTSRGSQGCFGLKLDRIGAASGLGCWRRIVDS |
Sequence map | 33 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|