| Primary information |
|---|
| ID | 11806 |
| Uniprot ID | P0DKY6 |
| Description | Natriuretic peptide NP2 (NP2_Casca) |
| Organism | Crotalus durissus cascavella |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Serpentes (snakes); Colubroidea; Viperidae; Crotalinae (pit vipers); Crotalus; Crotalus durissus (tropical rattlesnake); Cro |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the natriuretic peptide family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | Snake venom natriuretic peptide that shows an increase in perfusion pressure; urinary flow and glomerular filtration rate. Reduces total and proximal tubular transport of sodium. In the aortic ring assay; causes a relaxant effect in endothelium-intact thoracic aortic rings precontracted with phenylephrine in the presence and absence of isatin; a natriuretic receptor antagonist. |
| Length | 33 |
| Molecular Weight | 3 |
| Name | Natriuretic peptide NP2 (NP2_Casca) |
| Sequence | VSTSRGSQGCFGLKLDRIGAASGLGCWRRIVDS |
| Sequence map | 33 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|