| Primary information |
|---|
| ID | 11803 |
| Uniprot ID | Q766Y7 |
| Description | Calcitonin receptor-stimulating peptide 2 (CRSP-2) |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | Mainly expressed in the thyroid gland and CNS. Found in the nerve cells of the cerebrum; hippocampus; hypothalamus; pons/midbrain and thalamus. Also detected in the glia-like cells of pons/midbrain an |
| Post Translational Modification | NA |
| Function | NA |
| Length | 117 |
| Molecular Weight | 12 |
| Name | Calcitonin receptor-stimulating peptide 2 (CRSP-2) |
| Sequence | SCNTASCVTHKMTGWLSRSGSVAKNNFMPTNVDSKILG |
| Sequence map | 38 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|