| Primary information |
|---|
| ID | 11800 |
| Uniprot ID | Q9N0T2 |
| Description | Calcitonin gene-related peptide 1 (Alpha-type CGRP) (Calcitonin gene-related peptide I) (CGRP-I) |
| Organism | Equus caballus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Perissodactyla (odd-toed ungulates); Equidae (horses); Equus; Equus; Equus caballus (Horse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | CGRP induces vasodilation. It dilates a variety of vessels including the coronary; cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. It also elevates platelet cAMP. |
| Length | 127 |
| Molecular Weight | 13 |
| Name | Calcitonin gene-related peptide 1 (Alpha-type CGRP) (Calcitonin gene-related peptide I) (CGRP-I) |
| Sequence | SCNTASCLTHRLAGLLSSAGSMANSNLLPTEMGFKVS |
| Sequence map | 37 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|