| Primary information |
|---|
| ID | 11793 |
| Uniprot ID | Q7ZXZ6 |
| Description | Augurin |
| Organism | Xenopus laevis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus; Xenopus laevis (African clawed frog) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the augurin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Probable hormone that may attenuate cell proliferation and induce senescence in the central nervous system. |
| Length | 136 |
| Molecular Weight | 16 |
| Name | Augurin |
| Sequence | QLWDRTRPEVQQWYQQFLYMGFDEAKYEDDMSYWKNQGRGGSEYYGGFHQHHYDEDAAIGPR |
| Sequence map | 62 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|