Primary information |
---|
ID | 11792 |
Uniprot ID | Q99LS0 |
Description | Augurin (Esophageal cancer-related gene 4 protein homolog) |
Organism | Mus musculus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
Subcellular Location | Secreted |
Developmental Stage | At embryonic stage 14.5 dpc; primarily expressed in the choroid plexus; and low expression in the heart and cartilage (at protein level) (PubMed-21349154). At 18.5 dpc; expressed in adrenal cortex; ch |
Similarity | Belongs to the augurin family. |
Tissue Specificity | Expressed in the intermediate lobe of pituitary; glomerular layer of adrenal cortex; choroid plexus and atrioventricular node of the heart (PubMed-17284679). Expressed in the brain with high expressio |
Post Translational Modification | NA |
Function | Probable hormone that may attenuate cell proliferation and induce senescence of oligodendrocyte and neural precursor cells in the central nervous system |
Length | 148 |
Molecular Weight | 16 |
Name | Augurin (Esophageal cancer-related gene 4 protein homolog) |
Sequence | QLWDRTRPEVQQWYQQFLYMGFDEAKFEDDVNYWLNRNRNGHDYYGDYYQRHYDEDAAIGPH |
Sequence map | 62 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|