Primary information |
---|
ID | 11781 |
Uniprot ID | P30880 |
Description | Calcitonin gene-related peptide (CGRP) |
Organism | Sus scrofa |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | CGRP induces vasodilation. It dilates a variety of vessels including the coronary; cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. |
Length | 37 |
Molecular Weight | 3 |
Name | Calcitonin gene-related peptide (CGRP) |
Sequence | SCNTATCVTHRLAGLLSRSGGMVKSNFVPTDVGSEAF |
Sequence map | 37 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|