| Primary information |
|---|
| ID | 11772 |
| Uniprot ID | P12969 |
| Description | Islet amyloid polypeptide (Amylin) (Diabetes-associated peptide) (DAP) |
| Organism | Rattus norvegicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Rattus; Rattus norvegicus (Rat) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | Abundant in the islets of Langerhans but is not present in the brain or seven other tissues examined. |
| Post Translational Modification | NA |
| Function | Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle; while not affecting adipocyte glucose metabolism. |
| Length | 93 |
| Molecular Weight | 10 |
| Name | Islet amyloid polypeptide (Amylin) (Diabetes-associated peptide) (DAP) |
| Sequence | KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY |
| Sequence map | 37 |
| PDB ID | 2KJ7; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The mature protein is largely unstructured in the |
| Pharmaceutical Use | NA
|