| Primary information |
|---|
| ID | 11770 |
| Uniprot ID | Q29119 |
| Description | Islet amyloid polypeptide (Amylin) (Fragment) |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle; while not affecting adipocyte glucose metabolism. |
| Length | 32 |
| Molecular Weight | 3 |
| Name | Islet amyloid polypeptide (Amylin) (Fragment) |
| Sequence | NMATCATQHLANFLDRSRNNLGTIFSPTKVGS |
| Sequence map | 32 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | The mature protein is largely unstructured in the |
| Pharmaceutical Use | NA
|