Primary information |
---|
ID | 11767 |
Uniprot ID | P23442 |
Description | Islet amyloid polypeptide (Amylin) |
Organism | Mesocricetus auratus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Cricetidae; Cricetinae (hamsters); Mesocricetus; Mesocricetus auratus (Golden hamster) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the calcitonin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Selectively inhibits insulin-stimulated glucose utilization and glycogen deposition in muscle; while not affecting adipocyte glucose metabolism. |
Length | 92 |
Molecular Weight | 9 |
Name | Islet amyloid polypeptide (Amylin) |
Sequence | KCNTATCATQRLANFLVHSNNNLGPVLSPTNVGSNTY |
Sequence map | 37 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | The mature protein is largely unstructured in the |
Pharmaceutical Use | NA
|