| Primary information |
|---|
| ID | 11759 |
| Uniprot ID | P16501 |
| Description | Insulin-like growth factor I-A (IGF-I') (IGF-IA) (xIGF-1) (Somatomedin) |
| Organism | Xenopus laevis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amphibia; Batrachia; Anura; Pipoidea; Pipidae; Xenopodinae; Xenopus; Xenopus; Xenopus laevis (African clawed frog) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed both maternally and zygotically after the midblastula transition. Present both dorsally and ventrally at the beginning of neurulation. Expression is restricted to the developing heart at the |
| Similarity | Belongs to the insulin family. |
| Tissue Specificity | Expressed in adult liver; lung; heart; kidney and peritoneal fat. |
| Post Translational Modification | NA |
| Function | The insulin-like growth factors; isolated from plasma; are structurally and functionally related to insulin but have a much higher growth-promoting activity. Promotes head development by inhibiting Wnt signaling during embryogenesis |
| Length | 153 |
| Molecular Weight | 17 |
| Name | Insulin-like growth factor I-A (IGF-I') (IGF-IA) (xIGF-1) (Somatomedin) |
| Sequence | GPETLCGAELVDTLQFVCGDRGFYFSKPTGYGSNNRRSHHRGIVDECCFQSCDFRRLEMYCAPAKQAKSA |
| Sequence map | 70 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|