| Primary information |
|---|
| ID | 11752 |
| Uniprot ID | Q862B1 |
| Description | Calcitonin receptor-stimulating peptide 1 (CRSP-1) |
| Organism | Sus scrofa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Suina; Suidae (pigs); Sus; Sus scrofa (Pig) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | Mainly expressed in the thyroid gland and CNS. Found in the nerve cells of cerebrum; hippocampus; hypothalamus; pons/midbrain and thalamus. |
| Post Translational Modification | NA |
| Function | Stimulates cAMP production in porcine kidney cell line LLC-PK1 via the calcitonin receptor (CT) but not via the CT-like (CL) receptor. |
| Length | 126 |
| Molecular Weight | 14 |
| Name | Calcitonin receptor-stimulating peptide 1 (CRSP-1) |
| Sequence | SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG |
| Sequence map | 38 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|