Primary information |
---|
ID | 11734 |
Uniprot ID | P09859 |
Description | Gastrin/cholecystokinin-like peptide (Antral peptide) |
Organism | Gallus gallus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves; Neognathae; Galloanserae; Galliformes; Phasianidae (turkeys); Phasianinae; Gallus; Gallus gallus (Chicken) |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Potent stimulus of gastric acid; but not of pancreatic secretion. |
Length | 105 |
Molecular Weight | 11 |
Name | Gastrin/cholecystokinin-like peptide (Antral peptide) |
Sequence | DWPEPPSQEQQQRFISRFLPHVFAELSDRKGFVQGNGAVEALHDHFYPDWMDF |
Sequence map | 53 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|