Primary information |
---|
ID | 11733 |
Uniprot ID | Q4TTN8 |
Description | Apelin (APJ endogenous ligand) |
Organism | Danio rerio |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Danionidae; Danioninae; Danio; Danio rerio (Zebrafish) (Brachydanio rerio) |
Subcellular Location | Secreted |
Developmental Stage | Expressed at the end of gastrulation (at protein level) (PubMed-24407481). Expressed in the embryo from 7 to 48 hours post-fertilization (hpf) (PubMed-17336905). Expressed in the axial mesoderm and it |
Similarity | Belongs to the apelin family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | Endogenous ligand for the apelin receptor (aplnra and/or aplnrb) |
Length | 77 |
Molecular Weight | 8 |
Name | Apelin (APJ endogenous ligand) |
Sequence | GPMASTEHSKEIEEVGSMRTPLRQNPARAGRSQRPAGWRRRRPRPRLSHKGPMPF |
Sequence map | 55 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|