| Primary information |
|---|
| ID | 11733 |
| Uniprot ID | Q4TTN8 |
| Description | Apelin (APJ endogenous ligand) |
| Organism | Danio rerio |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Otomorpha; Ostariophysi; Otophysi; Cypriniphysae; Cypriniformes (carps and others); Cyprinoidei; Danionidae; Danioninae; Danio; Danio rerio (Zebrafish) (Brachydanio rerio) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed at the end of gastrulation (at protein level) (PubMed-24407481). Expressed in the embryo from 7 to 48 hours post-fertilization (hpf) (PubMed-17336905). Expressed in the axial mesoderm and it |
| Similarity | Belongs to the apelin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Endogenous ligand for the apelin receptor (aplnra and/or aplnrb) |
| Length | 77 |
| Molecular Weight | 8 |
| Name | Apelin (APJ endogenous ligand) |
| Sequence | GPMASTEHSKEIEEVGSMRTPLRQNPARAGRSQRPAGWRRRRPRPRLSHKGPMPF |
| Sequence map | 55 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|