| Primary information |
|---|
| ID | 11724 |
| Uniprot ID | P28374 |
| Description | Natriuretic peptide DNP |
| Organism | Dendroaspis angusticeps |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Serpentes (snakes); Colubroidea; Elapidae; Elapinae; Dendroaspis; Dendroaspis angusticeps (Eastern green mamba) (Naja angust |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the natriuretic peptide family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | Exhibits vasodilator; natriuretic and diuretic properties in animal models and human tissues. Acts by stimulating cGMP via the natriuretic peptide receptor A (NPR1). Is a poor agonist of the atrial natriuretic peptide receptor B (NPR2). Is not degraded by neutral endopeptidase (NEP/MME). Binds to atrial natriuretic peptide clearance receptor (NPR-C/NPR3); which may be responsible of the removal of DNP from the circulation. Increases calcium uptake and induces histamine release from rat peritoneal mast cells. Increases calcium-activated potassium (KCa) current in gastric antral circular smooth muscle cells by increasing cGMP production and activating inositol trisphosphate receptors (IP3Rs). |
| Length | 38 |
| Molecular Weight | 4 |
| Name | Natriuretic peptide DNP |
| Sequence | EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA |
| Sequence map | 38 |
| PDB ID | 7BRI; |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|