| Primary information |
|---|
| ID | 11717 |
| Uniprot ID | Q969E3 |
| Description | Urocortin-3 (Stresscopin) (Urocortin III) (Ucn III) |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Suppresses food intake; delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress. |
| Length | 161 |
| Molecular Weight | 17 |
| Name | Urocortin-3 (Stresscopin) (Urocortin III) (Ucn III) |
| Sequence | FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI |
| Sequence map | 38 |
| PDB ID | 2RMH; 3N93 |
| Drugpedia | NA |
| Receptor | Q13324; Q13324-2 |
| Domain | NA |
| Pharmaceutical Use | NA
|