| Primary information |
|---|
| ID | 11689 |
| Uniprot ID | Q3SAE5 |
| Description | Natriuretic peptide HsNP-b (Fragment) |
| Organism | Hoplocephalus stephensii |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Serpentes (snakes); Colubroidea; Elapidae; Notechinae; Hoplocephalus; Hoplocephalus stephensii (Stephens' banded snake) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the natriuretic peptide family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | Snake venom natriuretic peptide that exhibits hypotensive and vasodepressor activity. Acts by activating natriuretic receptors (NPR1 and/or NPR2 and/or NPR3). |
| Length | 40 |
| Molecular Weight | 4 |
| Name | Natriuretic peptide HsNP-b (Fragment) |
| Sequence | SDPKIGNGCFGFPIDRIGSVSGLGCNRLVQNPPKP |
| Sequence map | 35 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|