| Primary information |
|---|
| ID | 11686 |
| Uniprot ID | Q99ML8 |
| Description | Urocortin-2 (Urocortin II) (Ucn II) |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Rodentia; Myomorpha (mice and others); Muroidea; Muridae; Murinae; Mus; Mus; Mus musculus (Mouse) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | Glycosylated. |
| Function | Suppresses food intake; delays gastric emptying and decreases heat-induced edema. Might represent an endogenous ligand for maintaining homeostasis after stress. |
| Length | 113 |
| Molecular Weight | 12 |
| Name | Urocortin-2 (Urocortin II) (Ucn II) |
| Sequence | VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV |
| Sequence map | 38 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|