| Primary information |
|---|
| ID | 11685 |
| Uniprot ID | P0C171 |
| Description | Tuberoinfundibular peptide of 39 residues (TIP39) (Parathyroid hormone 2) |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Laurasiatheria; Artiodactyla; Ruminantia; Pecora; Bovidae; Bovinae; Bos (oxen; cattle); Bos taurus (Bovine) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the parathyroid hormone family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Plays a role as a potent and selective agonist of PTH2R resulting in adenyl cyclase activation and intracellular calcium levels elevation. Induces protein kinase C beta activation; recruitment of beta-arrestin and PTH2R internalization. May inhibit cell proliferation via its action of PTH2R activation. Neuropeptide which may also have a role in spermatogenesis. May activate nociceptors and nociceptive circuits. |
| Length | 100 |
| Molecular Weight | 11 |
| Name | Tuberoinfundibular peptide of 39 residues (TIP39) (Parathyroid hormone 2) |
| Sequence | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
| Sequence map | 39 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q1LZF7 |
| Domain | NA |
| Pharmaceutical Use | NA
|