| Primary information |
|---|
| ID | 11684 |
| Uniprot ID | O46166 |
| Description | U1-agatoxin-Ta1a (U1-AGTX-Ta1a) (Insecticidal toxin 1) (TaITX-1) |
| Organism | Eratigena agrestis |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Chelicerata; Arachnida; Araneae (spiders); Araneomorphae; Entelegynae; RTA clade; Agelenidae (funnel weavers); Eratigena; Eratigena agrestis (Hobo spider) (Tegenaria agrestis) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the helical arthropod-neuropeptide-derived (HAND) family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | Toxin that paralyzes insects. May have a direct effect on the insect central nervous system. |
| Length | 68 |
| Molecular Weight | 7 |
| Name | U1-agatoxin-Ta1a (U1-AGTX-Ta1a) (Insecticidal toxin 1) (TaITX-1) |
| Sequence | EPDEICRARMTHKEFNYKSNVCNGCGDQVAACEAECFRNDVYTACHEAQK |
| Sequence map | 50 |
| PDB ID | 2KSL; 6URP |
| Drugpedia | NA |
| Receptor | NA |
| Domain | Is exclusively composed of 4 tightly packed alpha |
| Pharmaceutical Use | NA
|