Primary information |
---|
ID | 11667 |
Uniprot ID | Q3SAE8 |
Description | Natriuretic peptide NsNP-a (Fragment) |
Organism | Notechis scutatus scutatus |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Sauropsida; Sauria (diapsids); Lepidosauria (lepidosaurs); Squamata (squamates); Bifurcata (split-tongued squamates); Unidentata; Episquamata; Toxicofera; Serpentes (snakes); Colubroidea; Elapidae; Acanthophiinae; Notechis; Notechis scutatus (mainland tiger snake); Notechis scut |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the natriuretic peptide family. |
Tissue Specificity | Expressed by the venom gland. |
Post Translational Modification | NA |
Function | Snake venom natriuretic peptide that exhibits hypotensive and vasodepressor activity. Acts by activating natriuretic receptors (NPR1 and/or NPR2 and/or NPR3). |
Length | 39 |
Molecular Weight | 3 |
Name | Natriuretic peptide NsNP-a (Fragment) |
Sequence | SGSEVAKIGDGCFGLPLDRIGSASGMGCRSVPKP |
Sequence map | 34 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|