| Primary information |
|---|
| ID | 11637 |
| Uniprot ID | P81039 |
| Description | Pituitary adenylate cyclase-activating polypeptide (PACAP) |
| Organism | Uranoscopus japonicus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Actinopterygii; Actinopteri; Neopterygii; Teleostei; Osteoglossocephalai; Clupeocephala; Euteleosteomorpha; Neoteleostei; Eurypterygia; Ctenosquamata; Acanthomorphata; Euacanthomorphacea; Percomorphaceae; Eupercaria; Uranoscopiformes (stargazers and others); Uranoscopidae (stargazers); Uranoscopus; Uranoscopus japonicus (Japanese star |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | PACAP plays pivotal roles as a neurotransmitter and/or a neuromodulator.; Stimulates adenylate cyclase in pituitary cells. |
| Length | 38 |
| Molecular Weight | 4 |
| Name | Pituitary adenylate cyclase-activating polypeptide (PACAP) |
| Sequence | HSDGIFTDSYSRYRKQMAVQKYLAAVLGRRYRQRVRNK |
| Sequence map | 38 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|