| Primary information |
|---|
| ID | 11636 |
| Uniprot ID | P68006 |
| Description | Neuropeptide Y (NPY) |
| Organism | Oryctolagus cuniculus |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Glires (Rodents and rabbits); Lagomorpha; Leporidae (rabbits and hares); Oryctolagus; Oryctolagus cuniculus (Rabbit) |
| Subcellular Location | Secreted Cytoplasmic vesicle; secretory vesicle; neuronal dense core vesicle |
| Developmental Stage | NA |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | One of the most abundant peptides in the nervous system. Also found in some chromaffin cells of the adrenal medulla. |
| Post Translational Modification | NA |
| Function | NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. |
| Length | 36 |
| Molecular Weight | 4 |
| Name | Neuropeptide Y (NPY) |
| Sequence | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Sequence map | 36 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P79217 |
| Domain | NA |
| Pharmaceutical Use | NA
|