| Primary information |
|---|
| ID | 11623 |
| Uniprot ID | Q7Q7R8 |
| Description | Neuropeptide F (Ang-NPF) |
| Organism | Anopheles gambiae |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Nematocera; Culicomorpha; Culicoidea; Culicidae (mosquitos); Anophelinae; Anopheles; Cellia; Pyretophorus; gambiae species complex; Anopheles gambiae (African malaria mosquito) |
| Subcellular Location | Secreted |
| Developmental Stage | Expressed both maternally and zygotically in larvae; pupae; and the heads of adults. |
| Similarity | Belongs to the NPY family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | An integral part of the sensory system that mediates food signaling; providing the neural basis for the regulation of food response; coordinates larval foraging and social behavior changes during development. May have a hormonal role in females. |
| Length | 89 |
| Molecular Weight | 9 |
| Name | Neuropeptide F (Ang-NPF) |
| Sequence | RPQDSDAASVAAAIRYLQELETKHAQHARPRF |
| Sequence map | 32 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|