Primary information |
---|
ID | 11623 |
Uniprot ID | Q7Q7R8 |
Description | Neuropeptide F (Ang-NPF) |
Organism | Anopheles gambiae |
Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Mandibulata; Pancrustacea; Hexapoda; Insecta; Dicondylia; Pterygota (winged insects); Neoptera; Endopterygota; Diptera; Nematocera; Culicomorpha; Culicoidea; Culicidae (mosquitos); Anophelinae; Anopheles; Cellia; Pyretophorus; gambiae species complex; Anopheles gambiae (African malaria mosquito) |
Subcellular Location | Secreted |
Developmental Stage | Expressed both maternally and zygotically in larvae; pupae; and the heads of adults. |
Similarity | Belongs to the NPY family. |
Tissue Specificity | NA |
Post Translational Modification | NA |
Function | An integral part of the sensory system that mediates food signaling; providing the neural basis for the regulation of food response; coordinates larval foraging and social behavior changes during development. May have a hormonal role in females. |
Length | 89 |
Molecular Weight | 9 |
Name | Neuropeptide F (Ang-NPF) |
Sequence | RPQDSDAASVAAAIRYLQELETKHAQHARPRF |
Sequence map | 32 |
PDB ID | NA |
Drugpedia | NA |
Receptor | NA |
Domain | NA |
Pharmaceutical Use | NA
|