| Primary information |
|---|
| ID | 11592 |
| Uniprot ID | V9QER4 |
| Description | Alpha-latrotoxin associated low molecular weight protein SGV242-280 (Alpha-latrotoxin-associated LMWP SGV242-280) (Latrodectin) |
| Organism | Steatoda grossa |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Protostomia; Ecdysozoa; Panarthropoda; Arthropoda; Chelicerata; Arachnida; Araneae (spiders); Araneomorphae; Entelegynae; Orbiculariae; Araneoidea; Theridiidae (cobweb weavers); Steatoda; Steatoda grossa (False black widow) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the arthropod CHH/MIH/GIH/VIH hormone family. |
| Tissue Specificity | Expressed by the venom gland. |
| Post Translational Modification | NA |
| Function | May increase the toxicity of alpha-latrotoxin and/or other venom components. Is non-toxic to mice and to the cockroach Periplaneta americana. |
| Length | 89 |
| Molecular Weight | 10 |
| Name | Alpha-latrotoxin associated low molecular weight protein SGV242-280 (Alpha-latrotoxin-associated LMW |
| Sequence | IEPQDIGCTGISTAEFEEKDATCSKCEEDYSGNGMIDRCRSDCYSGPFFKSCVELLNKGYDEKDENVKPEW |
| Sequence map | 71 |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | NA |
| Domain | NA |
| Pharmaceutical Use | NA
|