| Primary information |
|---|
| ID | 11520 |
| Uniprot ID | Q9YGP3 |
| Description | Glycoprotein hormones alpha chain precursor (Gonadotropin alpha chain)(GTH-alpha). |
| Organism | Ictalurus punctatus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Ostariophysi; Siluriformes;Ictaluridae; Ictalurus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit alpha family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Involved in gametogenesis and steroidogenesis |
| Length | 116 |
| Molecular Weight | 13089 |
| Name | Glycoprotein hormones alpha chain |
| Sequence | FPNNDFGCEECKLKENNIFSKPGAPVYQCMGCCFSRAYPTPLRSEKTMLVPKNITSEATCCVAKEVKRVIVNDVKLMNHTDCHCSTCYYHKF |
| Sequence map | 92 (25-116) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q6QMG1;Q98T84;Q98T85 |
| Domain | NA |
| Pharmaceutical Use | NA
|