| Primary information |
|---|
| ID | 11506 |
| Uniprot ID | Q86YW7 |
| Description | Glycoprotein hormone beta-5 precursor (Thyrostimulin subunit beta). |
| Organism | Homo sapiens |
| Txonomy | Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human) |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glycoprotein hormones subunit beta family. |
| Tissue Specificity | Highly expressed in brain and at low levels in pituitary. Also found in retina; testis and skin but not in pancreas; parotid; kidney; stomach; liver; colon; small intestine; thyroid; brain or adrenal |
| Post Translational Modification | N-glycosylated. |
| Function | Stimulates the thyroid. Binds and activates THSR; leading to increased cAMP production |
| Length | 130 |
| Molecular Weight | 14232 |
| Name | Glycoprotein hormone beta-5 |
| Sequence | ASSGNLRTFVGCAVREFTFLAKKPGCRGLRITTDACWGRCETWEKPILEPPYIEAHHRVCTYNETKQVTVKLPNCAPGVDPFYTYPVAIRCDCGACSTATTECETI |
| Sequence map | 106 (25-130) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P16473 |
| Domain | NA |
| Pharmaceutical Use | NA
|