| Primary information |
|---|
| ID | 11497 |
| Uniprot ID | P70160 |
| Description | Calcitonin precursor. |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the calcitonin family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones |
| Length | 136 |
| Molecular Weight | 15141 |
| Name | Calcitonin |
| Sequence | CGNLSTCMLGTYTQDLNKFHTFPQTSIGVEAP |
| Sequence map | 32 (85-116) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q60755 |
| Domain | NA |
| Pharmaceutical Use | NA
|