| Primary information |
|---|
| ID | 11480 |
| Uniprot ID | P55095 |
| Description | Glucagon precursor [Cleaved into- - Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)]. |
| Organism | Mus musculus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi;Muroidea; Muridae; Murinae; Mus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1; GLP-2; oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract. GLP1 and GLP2 |
| Post Translational Modification | Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells; the major bioactive hormone is glucagon cleaved by PCSK2/ |
| Function | GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine; concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract; from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis; enhancing nutrient assimilation through enhanced gastrointestinal function; as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability |
| Length | 180 |
| Molecular Weight | 20906 |
| Name | Glucagon-like peptide 2 |
| Sequence | HADGSFSDEMSTILDNLATRDFINWLIQTKITD |
| Sequence map | 33 (146-178) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q61606;Q3UN81 |
| Domain | NA |
| Pharmaceutical Use | NA
|