| Primary information |
|---|
| ID | 11467 |
| Uniprot ID | P49188 |
| Description | Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone). |
| Organism | Xenopus laevis |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Amphibia; Batrachia; Anura; Mesobatrachia; Pipoidea; Pipidae;Xenopodinae; Xenopus; Xenopus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | This hormone from hypothalamus regulates the release of corticotropin from pituitary gland |
| Length | 162 |
| Molecular Weight | 17880 |
| Name | Corticoliberin |
| Sequence | AEEPPISLDLTFHLLREVLEMARAEQIAQQAHSNRKLMDII |
| Sequence map | 41 (120-160) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | O42602;O42603 |
| Domain | NA |
| Pharmaceutical Use | NA
|