| Primary information |
|---|
| ID | 11455 |
| Uniprot ID | P41534 |
| Description | Glucagon family neuropeptides precursor [Cleaved into- - Growth hormone-releasing factor 1-46 (GRF) (Growth hormone-releasing hormone) (GHRH);Pituitary adenylate cyclase-activating polypeptide 27 (PACAP-27)(PACAP27); Pituitary adenylate cyclase-activating polypeptide 38(PACAP-38) (PACAP38)]. |
| Organism | Gallus gallus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Archosauria; Dinosauria; Saurischia; Theropoda; Coelurosauria; Aves;Neognathae; Galliformes; Phasianidae; Phasianinae; Gallus. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the glucagon family. |
| Tissue Specificity | NA |
| Post Translational Modification | NA |
| Function | Primary role of GRF is to release GH from the pituitary |
| Length | 175 |
| Molecular Weight | 19561 |
| Name | Growth hormone-releasing factor 1-46 |
| Sequence | KRHADGIFSKAYRKLLGQLSARNYLHSLMAKRVGGASSGLGDEAEPLS |
| Sequence map | 46 (83-128) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | Q7ZZJ9;Q309X7 |
| Domain | NA |
| Pharmaceutical Use | NA
|