Primary information |
---|
ID | 11449 |
Uniprot ID | P41520 |
Description | Cholecystokinins precursor (CCK) [Cleaved into- - Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
Organism | Bos taurus |
Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
Subcellular Location | Secreted |
Developmental Stage | NA |
Similarity | Belongs to the gastrin/cholecystokinin family. |
Tissue Specificity | NA |
Post Translational Modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas; binding to CCK-B receptors stimulates gastric acid secretion |
Length | 115 |
Molecular Weight | 12835 |
Name | Cholecystokinin-33 |
Sequence | KAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF |
Sequence map | 33 (71-103) |
PDB ID | NA |
Drugpedia | NA |
Receptor | P79266 |
Domain | NA |
Pharmaceutical Use | NA
|