| Primary information |
|---|
| ID | 11446 |
| Uniprot ID | P41520 |
| Description | Cholecystokinins precursor (CCK) [Cleaved into- - Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)]. |
| Organism | Bos taurus |
| Txonomy | Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos. |
| Subcellular Location | Secreted |
| Developmental Stage | NA |
| Similarity | Belongs to the gastrin/cholecystokinin family. |
| Tissue Specificity | NA |
| Post Translational Modification | The precursor cleaved by enzymes to produce a number of active cholecystokinins. |
| Function | This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas; binding to CCK-B receptors stimulates gastric acid secretion |
| Length | 115 |
| Molecular Weight | 12835 |
| Name | Cholecystokinin-58 |
| Sequence | AVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF |
| Sequence map | 58 (46-103) |
| PDB ID | NA |
| Drugpedia | NA |
| Receptor | P79266 |
| Domain | NA |
| Pharmaceutical Use | NA
|